Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYNGR2 polyclonal antibody (A01)

  • Catalog # : H00009144-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SYNGR2.
  • Immunogen:
  • SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009144-A01
    Western Blot detection against Immunogen (32.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SYNGR2 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of SYNGR2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9144
  • Gene Name:
  • SYNGR2
  • Gene Alias:
  • MGC102914
  • Gene Description:
  • synaptogyrin 2
  • Gene Summary:
  • This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. [provided by RefSeq
  • Other Designations:
  • cellugyrin
  • RSS
  • YouTube
  • Linkedin
  • Facebook