Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDCD5 (Human) Recombinant Protein (P01)

  • Catalog # : H00009141-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PDCD5 full-length ORF ( AAH15519, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.27
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009141-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9141
  • Gene Name:
  • PDCD5
  • Gene Alias:
  • MGC9294,TFAR19
  • Gene Description:
  • programmed cell death 5
  • Gene Summary:
  • This gene encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. Once apoptosis is induced, the level of this protein increases and by relocation from the cytoplasm, it accumulates in the nucleus. Although its exact function is not defined, this protein is thought to play an early and universal role in apoptosis. [provided by RefSeq
  • Other Designations:
  • TF1 cell apoptosis-related gene 19,TFAR19 novel apoptosis-related
  • RSS
  • YouTube
  • Linkedin
  • Facebook