PDCD5 purified MaxPab mouse polyclonal antibody (B03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PDCD5 expression in transfected 293T cell line (H00009141-T06) by PDCD5 MaxPab polyclonal antibody.
Lane 1: PDCD5 transfected lysate(14.3 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PDCD5 protein.
Immunogen
PDCD5 (NP_004699.1, 1 a.a. ~ 125 a.a) full-length human protein.
Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PDCD5 expression in transfected 293T cell line (H00009141-T06) by PDCD5 MaxPab polyclonal antibody.
Lane 1: PDCD5 transfected lysate(14.3 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PDCD5
Entrez GeneID
9141GeneBank Accession#
NM_004708.2Protein Accession#
NP_004699.1Gene Name
PDCD5
Gene Alias
MGC9294, TFAR19
Gene Description
programmed cell death 5
Omim ID
604583Gene Ontology
HyperlinkGene Summary
This gene encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. Once apoptosis is induced, the level of this protein increases and by relocation from the cytoplasm, it accumulates in the nucleus. Although its exact function is not defined, this protein is thought to play an early and universal role in apoptosis. [provided by RefSeq
Other Designations
TF1 cell apoptosis-related gene 19|TFAR19 novel apoptosis-related
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com