Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDCD5 purified MaxPab mouse polyclonal antibody (B03P)MaxPab

  • Catalog # : H00009141-B03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PDCD5 protein.
  • Immunogen:
  • PDCD5 (NP_004699.1, 1 a.a. ~ 125 a.a) full-length human protein.
  • Sequence:
  • MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PDCD5 expression in transfected 293T cell line (H00009141-T06) by PDCD5 MaxPab polyclonal antibody.

    Lane 1: PDCD5 transfected lysate(14.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9141
  • Gene Name:
  • PDCD5
  • Gene Alias:
  • MGC9294,TFAR19
  • Gene Description:
  • programmed cell death 5
  • Gene Summary:
  • This gene encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. Once apoptosis is induced, the level of this protein increases and by relocation from the cytoplasm, it accumulates in the nucleus. Although its exact function is not defined, this protein is thought to play an early and universal role in apoptosis. [provided by RefSeq
  • Other Designations:
  • TF1 cell apoptosis-related gene 19,TFAR19 novel apoptosis-related
  • RSS
  • YouTube
  • Linkedin
  • Facebook