CBFA2T2 monoclonal antibody (M15), clone 2C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CBFA2T2.
Immunogen
CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody (M15), clone 2C10.
Lane 1: CBFA2T2 transfected lysate(63.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CBFA2T2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBFA2T2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CBFA2T2
Entrez GeneID
9139GeneBank Accession#
NM_001032999Protein Accession#
NP_001028171.1Gene Name
CBFA2T2
Gene Alias
DKFZp313F2116, EHT, MTGR1, ZMYND3
Gene Description
core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Omim ID
603672Gene Ontology
HyperlinkGene Summary
In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described. [provided by RefSeq
Other Designations
ETO homolog on chromosome 20|MTG8-like protein|OTTHUMP00000030653|myeloid translocation gene-related protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com