KCNQ4 monoclonal antibody (M01), clone 2H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNQ4.
Immunogen
KCNQ4 (NP_004691, 596 a.a. ~ 695 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KCNQ4 monoclonal antibody (M01), clone 2H6 Western Blot analysis of KCNQ4 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
KCNQ4 monoclonal antibody (M01), clone 2H6. Western Blot analysis of KCNQ4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNQ4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — KCNQ4
Entrez GeneID
9132GeneBank Accession#
NM_004700Protein Accession#
NP_004691Gene Name
KCNQ4
Gene Alias
DFNA2, KV7.4
Gene Description
potassium voltage-gated channel, KQT-like subfamily, member 4
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000009219|potassium channel KQT-like 4|potassium voltage-gated channel KQT-like protein 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com