Product Browser

Last updated: 2017/3/19
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDCD8 polyclonal antibody (A01)

  • Catalog # : H00009131-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PDCD8.
  • Immunogen:
  • PDCD8 (NP_004199, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9131
  • Gene Name:
  • AIFM1
  • Gene Alias:
  • AIF,MGC111425,PDCD8
  • Gene Description:
  • apoptosis-inducing factor, mitochondrion-associated, 1
  • Gene Summary:
  • This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Several alternative transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024007,OTTHUMP00000024008,OTTHUMP00000024009,programmed cell death 8,programmed cell death 8 (apoptosis-inducing factor),striatal apoptosis-inducing factor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook