Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FAM50A polyclonal antibody (A01)

  • Catalog # : H00009130-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FAM50A.
  • Immunogen:
  • FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009130-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FAM50A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of FAM50A expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FAM50A polyclonal antibody (A01), Lot # 060428JCS1 Western Blot analysis of FAM50A expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FAM50A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of FAM50A expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FAM50A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of FAM50A expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9130
  • Gene Name:
  • FAM50A
  • Gene Alias:
  • 9F,DXS9928E,HXC-26,XAP5
  • Gene Description:
  • family with sequence similarity 50, member A
  • Gene Summary:
  • This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032117,OTTHUMP00000061460,XAP-5 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook