SEC22C (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SEC22C full-length ORF ( NP_116752.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSDCGV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
60.7
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SEC22C
Entrez GeneID
9117GeneBank Accession#
NM_032970.2Protein Accession#
NP_116752.1Gene Name
SEC22C
Gene Alias
DKFZp761F2321, MGC13261, MGC5373, SEC22L3
Gene Description
SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
Omim ID
604028Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000162608|SEC22 vesicle trafficking protein homolog C|SEC22 vesicle trafficking protein-like 3|secretion deficient 22C|vesicle trafficking protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com