Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEC22L3 polyclonal antibody (A01)

  • Catalog # : H00009117-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SEC22L3.
  • Immunogen:
  • SEC22L3 (NP_116752, 3 a.a. ~ 68 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009117-A01
    Western Blot detection against Immunogen (33.37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9117
  • Gene Name:
  • SEC22C
  • Gene Alias:
  • DKFZp761F2321,MGC13261,MGC5373,SEC22L3
  • Gene Description:
  • SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000162608,SEC22 vesicle trafficking protein homolog C,SEC22 vesicle trafficking protein-like 3,secretion deficient 22C,vesicle trafficking protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook