Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6V0D1 monoclonal antibody (M01), clone 2G12

  • Catalog # : H00009114-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1.
  • Immunogen:
  • ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009114-M01
    Western Blot detection against Immunogen (33.55 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATP6V0D1 monoclonal antibody (M01), clone 2G12 Western Blot analysis of ATP6V0D1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12.

    Lane 1: ATP6V0D1 transfected lysate(40.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ATP6V0D1 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9114
  • Gene Name:
  • ATP6V0D1
  • Gene Alias:
  • ATP6D,ATP6DV,P39,VATX,VMA6,VPATPD
  • Gene Description:
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
  • Gene Summary:
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D,ATPase, H+ transporting, lysosomal 38kD, V0 subunit d,ATPase, H+ transporting, lysosomal, V0 subunit d1,H(+)-transporting two-sector ATPase, subunit D,V-ATPase 40 KDa accessory protein,V-
  • RSS
  • YouTube
  • Linkedin
  • Facebook