MTA1 monoclonal antibody (M02), clone 4D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MTA1.
Immunogen
MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (91)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
MTA1 monoclonal antibody (M02), clone 4D11. Western Blot analysis of MTA1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
MTA1 monoclonal antibody (M02), clone 4D11 Western Blot analysis of MTA1 expression in Hela S3 NE ( Cat # L013V3 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MTA1
Entrez GeneID
9112GeneBank Accession#
NM_004689Protein Accession#
NP_004680Gene Name
MTA1
Gene Alias
-
Gene Description
metastasis associated 1
Omim ID
603526Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq
Other Designations
metastasis associated gene 1 protein|metastasis associated protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com