MTA1 monoclonal antibody (M01), clone 4D5

Catalog # H00009112-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

MTA1 monoclonal antibody (M01), clone 4D5 Western Blot analysis of MTA1 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in IMR-32 ( Cat # L008V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in NIH/3T3 ( Cat # L018V1 ).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to MTA1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant MTA1.

    Immunogen

    MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (96); Rat (91)

    Isotype

    IgG3 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    MTA1 monoclonal antibody (M01), clone 4D5 Western Blot analysis of MTA1 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in IMR-32 ( Cat # L008V1 ).

    Western Blot (Cell lysate)

    MTA1 monoclonal antibody (M01), clone 4D5. Western Blot analysis of MTA1 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to MTA1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.

    ELISA

  • Gene Info — MTA1

    Entrez GeneID

    9112

    GeneBank Accession#

    NM_004689

    Protein Accession#

    NP_004680

    Gene Name

    MTA1

    Gene Alias

    -

    Gene Description

    metastasis associated 1

    Omim ID

    603526

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq

    Other Designations

    metastasis associated gene 1 protein|metastasis associated protein

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All