RGN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RGN MaxPab polyclonal antibody. Western Blot analysis of RGN expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of RGN expression in transfected 293T cell line (H00009104-T01) by RGN MaxPab polyclonal antibody.
Lane 1: RGN transfected lysate(32.89 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RGN protein.
Immunogen
RGN (NP_004674.1, 1 a.a. ~ 299 a.a) full-length human protein.
Sequence
MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RGN MaxPab polyclonal antibody. Western Blot analysis of RGN expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of RGN expression in transfected 293T cell line (H00009104-T01) by RGN MaxPab polyclonal antibody.
Lane 1: RGN transfected lysate(32.89 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RGN
Entrez GeneID
9104GeneBank Accession#
NM_004683.4Protein Accession#
NP_004674.1Gene Name
RGN
Gene Alias
RC, SMP30
Gene Description
regucalcin (senescence marker protein-30)
Omim ID
300212Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000023195|OTTHUMP00000023196|regucalcin|senescence marker protein-30
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com