Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
3 for 2
pathway

USP14 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009097-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human USP14 partial ORF ( NP_005142, 395 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009097-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9097
  • Gene Name:
  • USP14
  • Gene Alias:
  • TGT
  • Gene Description:
  • ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
  • Gene Summary:
  • This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • deubiquitinating enzyme 14,tRNA-guanine transglycosylase, 60-kD subunit,ubiquitin carboxyl-terminal hydrolase 14,ubiquitin specific protease 14,ubiquitin specific protease 14 (tRNA-guanine transglycosylase),ubiquitin thiolesterase 14,ubiquitin-specific pr
  • RSS
  • YouTube
  • Linkedin
  • Facebook