USP14 monoclonal antibody (M04), clone 6D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6 Western Blot analysis of USP14 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody (M04), clone 6D6.
Lane 1: USP14 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP14 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP14.
Immunogen
USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6 Western Blot analysis of USP14 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody (M04), clone 6D6.
Lane 1: USP14 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP14 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — USP14
Entrez GeneID
9097GeneBank Accession#
NM_005151Protein Accession#
NP_005142Gene Name
USP14
Gene Alias
TGT
Gene Description
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Omim ID
607274Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
deubiquitinating enzyme 14|tRNA-guanine transglycosylase, 60-kD subunit|ubiquitin carboxyl-terminal hydrolase 14|ubiquitin specific protease 14|ubiquitin specific protease 14 (tRNA-guanine transglycosylase)|ubiquitin thiolesterase 14|ubiquitin-specific pr
-
Interactome
-
Publication Reference
-
Ubiquitin-specific protease-14 reduces cellular aggregates and protects against mutant huntingtin-induced cell degeneration: involvement of the proteasome and ER stress-activated kinase IRE1α.
Hyrskyluoto A, Bruelle C, Lundh SH, Do HT, Kivinen J, Rappou E, Reijonen S, Waltimo T, Petersen A, Lindholm D, Korhonen L.
Human Molecular Genetics 2014 Nov; 23(22):5928.
Application：IP-WB, WB-Tr, Human, PC6.3, HeLa cells.
-
Ubiquitin-specific protease-14 reduces cellular aggregates and protects against mutant huntingtin-induced cell degeneration: involvement of the proteasome and ER stress-activated kinase IRE1α.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com