TBX18 monoclonal antibody (M06), clone 4D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TBX18.
Immunogen
TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TBX18 monoclonal antibody (M06), clone 4D3. Western Blot analysis of TBX18 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
TBX18 monoclonal antibody (M06), clone 4D3. Western Blot analysis of TBX18 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
TBX18 monoclonal antibody (M06), clone 4D3 Western Blot analysis of TBX18 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TBX18 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TBX18
-
Interactome
-
Publication Reference
-
LEFTY-PITX2 signaling pathway is critical for generation of mature and ventricular cardiac organoids in human pluripotent stem cell-derived cardiac mesoderm cells.
Myeong-Hwa Song, Seung-Cheol Choi, Ji-Min Noh, Hyung Joon Joo, Chi-Yeon Park, Jung-Joon Cha, Tae Hoon Ahn, Tae Hee Ko, Jong-Il Choi, Ji Eun Na, Im Joo Rhyu, Yongjun Jang, Yongdoo Park, Jeong-An Gim, Jong-Hoon Kim, Do-Sun Lim.
Biomaterials 2021 Nov; 278:121133.
Application:Flow Cyt, IF, WB-Ce, Human, Human pluripotent stem cell-derived cardiac mesoderm cells.
-
LEFTY-PITX2 signaling pathway is critical for generation of mature and ventricular cardiac organoids in human pluripotent stem cell-derived cardiac mesoderm cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com