TBX19 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human TBX19 full-length ORF ( ABZ92200.1, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.3
Interspecies Antigen Sequence
Mouse (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TBX19
Entrez GeneID
9095GeneBank Accession#
EU446671.1Protein Accession#
ABZ92200.1Gene Name
TBX19
Gene Alias
FLJ26302, FLJ34543, TBS19, TPIT, dJ747L4.1
Gene Description
T-box 19
Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. [provided by RefSeq
Other Designations
OTTHUMP00000032583|T-box factor, pituitary|T-box protein 19|T-box transcription factor TBX19|TBS 19
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com