Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UNC119 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00009094-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human UNC119 protein.
  • Immunogen:
  • UNC119 (NP_005139.1, 1 a.a. ~ 240 a.a) full-length human protein.
  • Sequence:
  • MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UNC119 expression in transfected 293T cell line (H00009094-T02) by UNC119 MaxPab polyclonal antibody.

    Lane 1: UNC119 transfected lysate(27.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of UNC119 transfected lysate using anti-UNC119 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UNC119 purified MaxPab mouse polyclonal antibody (B01P) (H00009094-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9094
  • Gene Name:
  • UNC119
  • Gene Alias:
  • HRG4
  • Gene Description:
  • unc-119 homolog (C. elegans)
  • Gene Summary:
  • This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • retinal protein 4,unc119 (C.elegans) homolog,unc119 homolog
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook