UNC119 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UNC119 expression in transfected 293T cell line (H00009094-T01) by UNC119 MaxPab polyclonal antibody.
Lane 1: UNC119 transfected lysate(26.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of UNC119 transfected lysate using anti-UNC119 MaxPab mouse polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with UNC119 monoclonal antibody (M01), clone 2F9-2A9 (H00009094-M01).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UNC119 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UNC119 protein.
Immunogen
UNC119 (NP_005139.1, 1 a.a. ~ 240 a.a) full-length human protein.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UNC119 expression in transfected 293T cell line (H00009094-T01) by UNC119 MaxPab polyclonal antibody.
Lane 1: UNC119 transfected lysate(26.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of UNC119 transfected lysate using anti-UNC119 MaxPab mouse polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with UNC119 monoclonal antibody (M01), clone 2F9-2A9 (H00009094-M01).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to UNC119 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UNC119
Entrez GeneID
9094GeneBank Accession#
NM_005148.2Protein Accession#
NP_005139.1Gene Name
UNC119
Gene Alias
HRG4
Gene Description
unc-119 homolog (C. elegans)
Omim ID
604011Gene Ontology
HyperlinkGene Summary
This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
retinal protein 4|unc119 (C.elegans) homolog|unc119 homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com