CLDN2 monoclonal antibody (M01), clone 3F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CLDN2.
Immunogen
CLDN2 (NP_065117, 29 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.46 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLDN2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CLDN2
Entrez GeneID
9075GeneBank Accession#
NM_020384Protein Accession#
NP_065117Gene Name
CLDN2
Gene Alias
-
Gene Description
claudin 2
Omim ID
300520Gene Ontology
HyperlinkGene Summary
Members of the claudin protein family, such as CLDN2, are expressed in an organ-specific manner and regulate the tissue-specific physiologic properties of tight junctions (Sakaguchi et al., 2002 [PubMed 11934881]).[supplied by OMIM
Other Designations
OTTHUMP00000023793
-
Interactome
-
Pathway
-
Publication Reference
-
A novel microfluidics-based method for probing weak protein-protein interactions.
Tan DC, Wijaya IP, Andreasson-Ochsner M, Vasina EN, Nallani M, Hunziker W, Sinner EK.
Lab on A Chip 2012 Aug; 12(15):2726.
Application:Cell Culture, Recombinant protein.
-
Proteopolymersomes: In vitro production of a membrane protein in polymersome membranes.
Nallani M, Andreasson-Ochsner M, Darren Tan CW, Sinner EK, Wisantoso Y, Geifman-Shochat S, Hunziker W.
Biointerphases 2011 Dec; 6(4):153.
Application:Injection, Recombinant protein.
-
Probing Effects of pH change on Dynamic Response of Claudin-2 Mediated Adhesion Using Single Molecule Force Spectroscopy.
Lim TS, Vedula SR, Huic S, Kausalya PJ, Hunzikerd W, Lim CT.
Experimental Cell Research 2008 Jun; 314(14):2643.
Application:IF, Recombinant protein.
-
Kinetics of Adhesion Mediated by Extracellular Loops of Claudin-2 as Revealed by Single Molecule Force Spectroscopy.
Lim TS, Vedula SR, Hunziker W, Lim CT.
Journal of Molecular Biology 2008 Jun; 381(3):681.
Application:IF, Recombinant protein.
-
A novel microfluidics-based method for probing weak protein-protein interactions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com