CLDN8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CLDN8 full-length ORF ( NP_955360.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.2
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CLDN8
Entrez GeneID
9073GeneBank Accession#
NM_199328.1Protein Accession#
NP_955360.1Gene Name
CLDN8
Gene Alias
-
Gene Description
claudin 8
Omim ID
611231Gene Ontology
HyperlinkGene Summary
Claudins, such as CLDN8, are components of epithelial cell tight junctions. Tight junctions regulate movement of solutes and ions through the paracellular space and prevent mixing of proteins and lipids in the outer leaflet of the apical and basolateral plasma membrane domains (Acharya et al., 2004).[supplied by OMIM
Other Designations
OTTHUMP00000101915
-
Interactome
-
Pathway
-
Publication Reference
-
Campylobacter jejuni Serine Protease HtrA Cleaves the Tight Junction Component Claudin-8.
Irshad Sharafutdinov, Delara Soltan Esmaeili, Aileen Harrer, Nicole Tegtmeyer, Heinrich Sticht, Steffen Backert.
Frontiers in Cellular and Infection Microbiology 2020 Dec; 10:590186.
Application:Enzyme, WB-Re, N/A, Recombinant proteins.
-
Helicobacter pylori Employs a Unique Basolateral Type IV Secretion Mechanism for CagA Delivery.
Tegtmeyer N, Wessler S, Necchi V, Rohde M, Harrer A, Rau TT, Asche CI, Boehm M, Loessner H, Figueiredo C, Naumann M, Palmisano R, Solcia E, Ricci V, Backert S.
Cell Host & Microbe 2017 Oct; 22(4):552.
Application:Func, HtrA.
-
Campylobacter jejuni Serine Protease HtrA Cleaves the Tight Junction Component Claudin-8.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com