Product Browser

Last updated: 2017/12/10
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASH2L monoclonal antibody (M21A), clone 1B4

  • Catalog # : H00009070-M21A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ASH2L.
  • Immunogen:
  • ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009070-M21A
    Western Blot detection against Immunogen (37.51 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ASH2L monoclonal antibody (M21A), clone 1B4. Western Blot analysis of ASH2L expression in Jurkat(Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9070
  • Gene Name:
  • ASH2L
  • Gene Alias:
  • ASH2,ASH2L1,ASH2L2,Bre2
  • Gene Description:
  • ash2 (absent, small, or homeotic)-like (Drosophila)
  • Other Designations:
  • ash2-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook