Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAPSS2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009060-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAPSS2 partial ORF ( NP_004661, 513 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009060-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9060
  • Gene Name:
  • PAPSS2
  • Gene Alias:
  • ATPSK2,SK2
  • Gene Description:
  • 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • Gene Summary:
  • Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2,ATP sulfurylase/APS kinase 2,ATP sulfurylase/adenosine 5'-phosphosulfate kinase,PAPS synthase 2,PAPS synthetase 2,bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2,phosphoadenosine-
  • RSS
  • YouTube
  • Linkedin
  • Facebook