PAPSS2 monoclonal antibody (M07), clone 2A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
Immunogen
PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAPSS2 monoclonal antibody (M07), clone 2A8 Western Blot analysis of PAPSS2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
PAPSS2 monoclonal antibody (M07), clone 2A8. Western Blot analysis of PAPSS2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody (M07), clone 2A8.
Lane 1: PAPSS2 transfected lysate(69.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAPSS2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi ( Cat # H00009060-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody (M07), clone 2A8 (Cat # H00009060-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PAPSS2 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — PAPSS2
Entrez GeneID
9060GeneBank Accession#
NM_004670Protein Accession#
NP_004661Gene Name
PAPSS2
Gene Alias
ATPSK2, SK2
Gene Description
3'-phosphoadenosine 5'-phosphosulfate synthase 2
Omim ID
603005Gene Ontology
HyperlinkGene Summary
Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq
Other Designations
3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2|ATP sulfurylase/APS kinase 2|ATP sulfurylase/adenosine 5'-phosphosulfate kinase|PAPS synthase 2|PAPS synthetase 2|bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2|phosphoadenosine-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
PAPSS2 promotes alkaline phosphates activity and mineralization of osteoblastic MC3T3-E1 cells by crosstalk and Smads signal pathways.
Wang W, Li F, Wang K, Cheng B, Guo X.
PLoS One 2012 Aug; 7(8):e43475.
Application:WB, Mouse, MC3T3 cells.
-
Old Astrocyte Specifically Induced Substance Induces Expression of Genes Involved in Extracellular Matrix Production But Not Classical Endoplasmic Reticulum Stress Response Genes in Pancreatic {beta}-Cells.
Ravi N Vellanki, Liling Zhang, Michelle A Guney, Jonathan V Rocheleau, Maureen Gannon, Allen Volchuk.
Endocrinology 2010 Sep; 151(9):4146.
Application:WB-Ce, WB-Tr, Rat, INS-1 cells.
-
PAPSS2 promotes alkaline phosphates activity and mineralization of osteoblastic MC3T3-E1 cells by crosstalk and Smads signal pathways.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com