Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Scientific Image Contest
pathway

PAPSS2 monoclonal antibody (M07), clone 2A8

  • Catalog # : H00009060-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
  • Immunogen:
  • PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009060-M07
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PAPSS2 monoclonal antibody (M07), clone 2A8 Western Blot analysis of PAPSS2 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PAPSS2 monoclonal antibody (M07), clone 2A8. Western Blot analysis of PAPSS2 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PAPSS2 expression in transfected 293T cell line by PAPSS2 monoclonal antibody (M07), clone 2A8.

    Lane 1: PAPSS2 transfected lysate(69.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PAPSS2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of PAPSS2 over-expressed 293 cell line, cotransfected with PAPSS2 Validated Chimera RNAi ( Cat # H00009060-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS2 monoclonal antibody (M07), clone 2A8 (Cat # H00009060-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9060
  • Gene Name:
  • PAPSS2
  • Gene Alias:
  • ATPSK2,SK2
  • Gene Description:
  • 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • Gene Summary:
  • Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2,ATP sulfurylase/APS kinase 2,ATP sulfurylase/adenosine 5'-phosphosulfate kinase,PAPS synthase 2,PAPS synthetase 2,bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2,phosphoadenosine-
  • RSS
  • YouTube
  • Linkedin
  • Facebook