Product Browser

Last updated: 2017/1/22
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAPSS2 polyclonal antibody (A01)

  • Catalog # : H00009060-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PAPSS2.
  • Immunogen:
  • PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009060-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9060
  • Gene Name:
  • PAPSS2
  • Gene Alias:
  • ATPSK2,SK2
  • Gene Description:
  • 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • Gene Summary:
  • Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2,ATP sulfurylase/APS kinase 2,ATP sulfurylase/adenosine 5'-phosphosulfate kinase,PAPS synthase 2,PAPS synthetase 2,bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2,phosphoadenosine-
  • RSS
  • YouTube
  • Linkedin
  • Facebook