Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC13A2 polyclonal antibody (A01)

  • Catalog # : H00009058-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC13A2.
  • Immunogen:
  • SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009058-A01
    Western Blot detection against Immunogen (34.36 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SLC13A2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of SLC13A2 expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9058
  • Gene Name:
  • SLC13A2
  • Gene Alias:
  • NADC1,NaDC-1
  • Gene Description:
  • solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook