Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC7A7 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009056-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC7A7 partial ORF ( NP_003973.2, 462 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009056-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9056
  • Gene Name:
  • SLC7A7
  • Gene Alias:
  • LAT3,LPI,MOP-2,Y+LAT1,y+LAT-1
  • Gene Description:
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Gene Summary:
  • The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164491,OTTHUMP00000164492,OTTHUMP00000164494,monocyte amino acid permease 2,solute carrier family 7 member 7,y(+)L-type amino acid transporter 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook