SPAG9 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SPAG9 full-length ORF ( ADZ15793.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEVRMVLLNILQKVY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
14.5
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPAG9
Entrez GeneID
9043GeneBank Accession#
JF432576.1Protein Accession#
ADZ15793.1Gene Name
SPAG9
Gene Alias
FLJ13450, FLJ14006, FLJ26141, FLJ34602, HLC4, JLP, KIAA0516, MGC117291, MGC14967, MGC74461, PHET, PIG6
Gene Description
sperm associated antigen 9
Omim ID
605430Gene Ontology
HyperlinkGene Summary
Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
HLC-4 protein|JNK interacting protein|JNK-associated leucine-zipper protein|JNK/SAPK-associated protein|Max-binding protein|c-Jun NH2-terminal kinase-associated leucine zipper protein|lung cancer oncogene 4|proliferation-inducing gene 6|sperm specific pro
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com