Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPAG9 (Human) Recombinant Protein (P01)

  • Catalog # : H00009043-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SPAG9 full-length ORF ( AAH07524, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEVRMVLLNTLQKVY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.15
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009043-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9043
  • Gene Name:
  • SPAG9
  • Gene Alias:
  • FLJ13450,FLJ14006,FLJ26141,FLJ34602,HLC4,JLP,KIAA0516,MGC117291,MGC14967,MGC74461,PHET,PIG6
  • Gene Description:
  • sperm associated antigen 9
  • Gene Summary:
  • Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HLC-4 protein,JNK interacting protein,JNK-associated leucine-zipper protein,JNK/SAPK-associated protein,Max-binding protein,c-Jun NH2-terminal kinase-associated leucine zipper protein,lung cancer oncogene 4,proliferation-inducing gene 6,sperm specific pro
  • RSS
  • YouTube
  • Linkedin
  • Facebook