CCRL2 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CCRL2 protein.
Immunogen
CCRL2 (NP_003956, 1 a.a. ~ 344 a.a) full-length human protein.
Sequence
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and CCRL2 expressing 293 cells (Green) using CCRL2 purified MaxPab mouse polyclonal antibody.Western Blot (Transfected lysate)
Western Blot analysis of CCRL2 expression in transfected 293T cell line (H00009034-T02) by CCRL2 MaxPab polyclonal antibody.
Lane 1: CCRL2 transfected lysate(37.84 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCRL2
Entrez GeneID
9034GeneBank Accession#
NM_003965Protein Accession#
NP_003956Gene Name
CCRL2
Gene Alias
CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710
Gene Description
chemokine (C-C motif) receptor-like 2
Omim ID
608379Gene Ontology
HyperlinkGene Summary
This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq
Other Designations
chemokine receptor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com