Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCRL2 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00009034-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CCRL2 protein.
  • Immunogen:
  • CCRL2 (NP_003956, 1 a.a. ~ 344 a.a) full-length human protein.
  • Sequence:
  • MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Flow Cytometry
  • Flow Cytometry enlargeenlarge this image
  • FACS analysis of negative control 293 cells (Black) and CCRL2 expressing 293 cells (Green) using CCRL2 purified MaxPab mouse polyclonal antibody.
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCRL2 expression in transfected 293T cell line (H00009034-T02) by CCRL2 MaxPab polyclonal antibody.

    Lane 1: CCRL2 transfected lysate(37.84 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9034
  • Gene Name:
  • CCRL2
  • Gene Alias:
  • CKRX,CRAM-A,CRAM-B,FLJ55815,HCR,MGC116710
  • Gene Description:
  • chemokine (C-C motif) receptor-like 2
  • Gene Summary:
  • This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq
  • Other Designations:
  • chemokine receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook