RNF8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RNF8 full-length ORF ( AAH07517, 1 a.a. - 485 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
79.09
Interspecies Antigen Sequence
Mouse (71); Rat (73)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RNF8
Entrez GeneID
9025GeneBank Accession#
BC007517Protein Accession#
AAH07517Gene Name
RNF8
Gene Alias
FLJ12013, KIAA0646
Gene Description
ring finger protein 8
Omim ID
611685Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
C3HC4-type zinc finger protein|OTTHUMP00000016323|OTTHUMP00000039684|UBC13/UEV-interacting ring finger protein|ring finger protein (C3HC4 type) 8
-
Interactome
-
Disease
-
Publication Reference
-
Extracellular matrix stiffness determines DNA repair efficiency and cellular sensitivity to genotoxic agents.
Min Deng, Jing Lin, Somaira Nowsheen, Tongzheng Liu, Yingchun Zhao, Peter W Villalta, Delphine Sicard, Daniel J Tschumperlin, SeungBaek Lee, JungJin Kim, Zhenkun Lou.
Science Advances 2020 Sep; 6(37):eabb2630.
Application：Func, Recombinant proteins.
-
Solubility-based genetic screen identifies RING finger protein 126 as an E3 ligase for activation-induced cytidine deaminase.
Delker RK, Zhou Y, Strikoudis A, Stebbins CE, Papavasiliou FN.
PNAS 2012 Dec; 110(3):1029.
Application：Func, Human, GST-PCNA.
-
Non-canonical inhibition of DNA damage-dependent ubiquitination by OTUB1.
Nakada S, Tai I, Panier S, Al-Hakim A, Iemura S, Juang YC, O'Donnell L, Kumakubo A, Munro M, Sicheri F, Gingras AC, Natsume T, Suda T, Durocher D.
Nature 2010 Aug; 466(7309):941.
Application：Func, Recombinant protein.
-
Extracellular matrix stiffness determines DNA repair efficiency and cellular sensitivity to genotoxic agents.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com