RNF8 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RNF8 expression in transfected 293T cell line (H00009025-T02) by RNF8 MaxPab polyclonal antibody.
Lane 1: RNF8 transfected lysate(55.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RNF8 protein.
Immunogen
RNF8 (NP_003949.1, 1 a.a. ~ 485 a.a) full-length human protein.
Sequence
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF8 expression in transfected 293T cell line (H00009025-T02) by RNF8 MaxPab polyclonal antibody.
Lane 1: RNF8 transfected lysate(55.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RNF8
Entrez GeneID
9025GeneBank Accession#
NM_003958.2Protein Accession#
NP_003949.1Gene Name
RNF8
Gene Alias
FLJ12013, KIAA0646
Gene Description
ring finger protein 8
Omim ID
611685Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
C3HC4-type zinc finger protein|OTTHUMP00000016323|OTTHUMP00000039684|UBC13/UEV-interacting ring finger protein|ring finger protein (C3HC4 type) 8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com