RNF8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RNF8 protein.
Immunogen
RNF8 (NP_003949.1, 1 a.a. ~ 485 a.a) full-length human protein.
Sequence
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF8 expression in transfected 293T cell line (H00009025-T02) by RNF8 MaxPab polyclonal antibody.
Lane 1: RNF8 transfected lysate(53.35 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RNF8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RNF8
Entrez GeneID
9025GeneBank Accession#
NM_003958.2Protein Accession#
NP_003949.1Gene Name
RNF8
Gene Alias
FLJ12013, KIAA0646
Gene Description
ring finger protein 8
Omim ID
611685Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
C3HC4-type zinc finger protein|OTTHUMP00000016323|OTTHUMP00000039684|UBC13/UEV-interacting ring finger protein|ring finger protein (C3HC4 type) 8
-
Interactome
-
Disease
-
Publication Reference
-
RNF8 E3 Ubiquitin Ligase Stimulates Ubc13 E2 Conjugating Activity that is Essential for DNA Double-Strand Break Signaling and BRCA1 Tumor Suppressor Recruitment.
Hodge CD, Ismail IH, Edwards RA, Hura GL, Xiao AT, Tainer JA, Hendzel MJ, Glover JN.
Journal of Biological Chemistry 2016 Apr; 291(18):9396.
Application:WB, Mouse, MEF cells.
-
Epstein-Barr virus BZLF1 protein impairs accumulation of host DNA damage proteins at damage sites in response to DNA damage.
Yang J, Deng W, Hau PM, Liu J, Lau VM, Cheung AL, Huen MS, Tsao SW.
Laboratory Investigation 2015 Aug; 95(8):937.
Application:IF, Human, HONE1 cells.
-
Role of ATM in the Formation of Replication Compartment During Lytic Replication of EBV in Nasopharyngeal Epithelial Cells.
Hau PM, Deng W, Jia L, Yang J, Tsurumi T, Chiang AK, Huen MS, Tsao SW.
Journal of Virology 2015 Jan; 89(1):652.
Application:IF, Human, HONE1-EBV GFP cells.
-
The SUMO modification pathway is involved in the BRCA1 response to genotoxic stress.
Morris JR, Boutell C, Keppler M, Densham R, Weekes D, Alamshah A, Butler L, Galanty Y, Pangon L, Kiuchi T, Ng T, Solomon E.
Nature 2009 Dec; 462(7275):886.
Application:IF, Human, Monkey, COS-7, HeLa cells.
-
RNF8 E3 Ubiquitin Ligase Stimulates Ubc13 E2 Conjugating Activity that is Essential for DNA Double-Strand Break Signaling and BRCA1 Tumor Suppressor Recruitment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com