CLIC3 monoclonal antibody (M02), clone 3F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CLIC3.
Immunogen
CLIC3 (NP_004660, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLIC3 monoclonal antibody (M02), clone 3F8 Western Blot analysis of CLIC3 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CLIC3 expression in transfected 293T cell line by CLIC3 monoclonal antibody (M02), clone 3F8.
Lane 1: CLIC3 transfected lysate(26.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of CLIC3 transfected lysate using anti-CLIC3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLIC3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLIC3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CLIC3 on HeLa cell. [antibody concentration 15 ug/ml] -
Gene Info — CLIC3
Entrez GeneID
9022GeneBank Accession#
NM_004669Protein Accession#
NP_004660Gene Name
CLIC3
Gene Alias
-
Gene Description
chloride intracellular channel 3
Omim ID
606533Gene Ontology
HyperlinkGene Summary
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq
Other Designations
OTTHUMP00000022630
-
Interactome
-
Publication Reference
-
Chloride intercellular channel 3 (CLIC-3) suppression-mediated macrophage polarization: a potential indicator of poor prognosis of hepatitis B virus-related acute-on-chronic liver failure.
Jing Liang, Zijie Long, Yanyan Zhang, Jundan Wang, Xiaotong Chen, Xiangfu Liu, Yurong Gu, Wanling Zhang, Tong Zhang, Youming Chen, Genglin Zhang, Weijun Sun, Dongming Kuang, Zhiliang Gao, Yubao Zheng.
Immunology and Cell Biology 2022 May; 100(5):323.
Application:IF, Human, THP-1 cells.
-
Chloride intercellular channel 3 (CLIC-3) suppression-mediated macrophage polarization: a potential indicator of poor prognosis of hepatitis B virus-related acute-on-chronic liver failure.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com