Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MPZL1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00009019-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MPZL1 protein.
  • Immunogen:
  • MPZL1 (NP_003944.1, 1 a.a. ~ 269 a.a) full-length human protein.
  • Sequence:
  • MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MPZL1 expression in transfected 293T cell line (H00009019-T01) by MPZL1 MaxPab polyclonal antibody.

    Lane 1: MPZL1 transfected lysate(29.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MPZL1 transfected lysate using anti-MPZL1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MPZL1 purified MaxPab mouse polyclonal antibody (B01P) (H00009019-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9019
  • Gene Name:
  • MPZL1
  • Gene Alias:
  • FLJ21047,PZR,PZR1b,PZRa,PZRb
  • Gene Description:
  • myelin protein zero-like 1
  • Other Designations:
  • OTTHUMP00000032519,immunoglobulin family transmembrane protein,myelin protein zero-like protein MPZL1b,protein zero related
  • RSS
  • YouTube
  • Linkedin
  • Facebook