TAF1C monoclonal antibody (M02), clone 3E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAF1C.
Immunogen
TAF1C (NP_005670.2, 761 a.a. ~ 869 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (65); Rat (66)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TAF1C expression in transfected 293T cell line by TAF1C monoclonal antibody (M02), clone 3E6.
Lane 1: TAF1C transfected lysate(85.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAF1C is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TAF1C
Entrez GeneID
9013GeneBank Accession#
NM_005679Protein Accession#
NP_005670.2Gene Name
TAF1C
Gene Alias
MGC:39976, SL1, TAFI110, TAFI95
Gene Description
TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Omim ID
604905Gene Ontology
HyperlinkGene Summary
Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
SL1, 110kD subunit|TBP-associated factor 1C|transcription factor SL1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com