Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGLYRP1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00008993-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PGLYRP1 protein.
  • Immunogen:
  • PGLYRP1 (NP_005082.1, 1 a.a. ~ 196 a.a) full-length human protein.
  • Sequence:
  • MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PGLYRP1 expression in transfected 293T cell line (H00008993-T03) by PGLYRP1 MaxPab polyclonal antibody.

    Lane 1: PGLYRP1 transfected lysate(21.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8993
  • Gene Name:
  • PGLYRP1
  • Gene Alias:
  • MGC126894,MGC126896,PGLYRP,PGRP,PGRP-S,PGRPS,TAG7,TNFSF3L
  • Gene Description:
  • peptidoglycan recognition protein 1
  • Other Designations:
  • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook