Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRPA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008989-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TRPA1 partial ORF ( NP_015628, 1033 a.a. - 1117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008989-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8989
  • Gene Name:
  • TRPA1
  • Gene Alias:
  • ANKTM1
  • Gene Description:
  • transient receptor potential cation channel, subfamily A, member 1
  • Gene Summary:
  • The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq
  • Other Designations:
  • ankyrin-like protein 1,ankyrin-like with transmembrane domains 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook