TRPA1 monoclonal antibody (M03), clone 6G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8.
Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRPA1.
Immunogen
TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRPA1 expression in transfected 293T cell line by TRPA1 monoclonal antibody (M03), clone 6G8.
Lane 1: TRPA1 transfected lysate (Predicted MW: 123.09 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRPA1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TRPA1
Entrez GeneID
8989GeneBank Accession#
NM_007332Protein Accession#
NP_015628Gene Name
TRPA1
Gene Alias
ANKTM1
Gene Description
transient receptor potential cation channel, subfamily A, member 1
Omim ID
604775Gene Ontology
HyperlinkGene Summary
The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq
Other Designations
ankyrin-like protein 1|ankyrin-like with transmembrane domains 1
-
Interactome
-
Publication Reference
-
Transient Receptor Potential Ankyrin 1 Channel Involved in Atherosclerosis and Macrophage-Foam Cell Formation.
Zhao JF, Shyue SK, Kou YR, Lu TS, Lee TS.
International Journal of Biological Sciences 2016 May; 12(7):812.
Application：IHC, WB-Ti, Mouse, Aortas.
-
Transient Receptor Potential Ankyrin 1 Channel Involved in Atherosclerosis and Macrophage-Foam Cell Formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com