Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCAP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008935-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SCAP2 full-length ORF ( AAH02893, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 65.23
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008935-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8935
  • Gene Name:
  • SKAP2
  • Gene Alias:
  • MGC10411,MGC33304,PRAP,RA70,SAPS,SCAP2,SKAP-HOM,SKAP55R
  • Gene Description:
  • src kinase associated phosphoprotein 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the src family kinases. This protein is similar to the src kinase associated phosphoprotein 1. It is an adaptor protein that is thought to play an essential role in the src signaling pathway in various cells. It inhibits PTK2B/RAFTK activity and regulates alpha-synuclein phosphorylation. [provided by RefSeq
  • Other Designations:
  • Fyn-associated phosphoprotein SKAP55 homologue,Pyk2/RAFTK-associated protein,src family associated phosphoprotein 2,src kinase-associated phosphoprotein of 55-related protein,src-associated adaptor protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook