Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCAP2 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00008935-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SCAP2 protein.
  • Immunogen:
  • SCAP2 (AAH36044, 1 a.a. ~ 359 a.a) full-length human protein.
  • Sequence:
  • MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SKAP2 MaxPab polyclonal antibody. Western Blot analysis of SKAP2 expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SKAP2 expression in transfected 293T cell line (H00008935-T01) by SKAP2 MaxPab polyclonal antibody.

    Lane1:SCAP2 transfected lysate(39.6 KDa).
    Lane 2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8935
  • Gene Name:
  • SKAP2
  • Gene Alias:
  • MGC10411,MGC33304,PRAP,RA70,SAPS,SCAP2,SKAP-HOM,SKAP55R
  • Gene Description:
  • src kinase associated phosphoprotein 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the src family kinases. This protein is similar to the src kinase associated phosphoprotein 1. It is an adaptor protein that is thought to play an essential role in the src signaling pathway in various cells. It inhibits PTK2B/RAFTK activity and regulates alpha-synuclein phosphorylation. [provided by RefSeq
  • Other Designations:
  • Fyn-associated phosphoprotein SKAP55 homologue,Pyk2/RAFTK-associated protein,src family associated phosphoprotein 2,src kinase-associated phosphoprotein of 55-related protein,src-associated adaptor protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook