Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCAP2 polyclonal antibody (A02)

  • Catalog # : H00008935-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SCAP2.
  • Immunogen:
  • SCAP2 (NP_003921, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008935-A02
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SCAP2 polyclonal antibody (A02), Lot # 060626JCS1 Western Blot analysis of SCAP2 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8935
  • Gene Name:
  • SKAP2
  • Gene Alias:
  • MGC10411,MGC33304,PRAP,RA70,SAPS,SCAP2,SKAP-HOM,SKAP55R
  • Gene Description:
  • src kinase associated phosphoprotein 2
  • Gene Summary:
  • The protein encoded by this gene belongs to the src family kinases. This protein is similar to the src kinase associated phosphoprotein 1. It is an adaptor protein that is thought to play an essential role in the src signaling pathway in various cells. It inhibits PTK2B/RAFTK activity and regulates alpha-synuclein phosphorylation. [provided by RefSeq
  • Other Designations:
  • Fyn-associated phosphoprotein SKAP55 homologue,Pyk2/RAFTK-associated protein,src family associated phosphoprotein 2,src kinase-associated phosphoprotein of 55-related protein,src-associated adaptor protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook