RAB7L1 monoclonal antibody (M03), clone 2B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAB7L1 monoclonal antibody (M03), clone 2B8 Western Blot analysis of RAB7L1 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RAB7L1 expression in transfected 293T cell line by RAB7L1 monoclonal antibody (M03), clone 2B8.
Lane 1: RAB7L1 transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB7L1 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RAB7L1 over-expressed 293 cell line, cotransfected with RAB7L1 Validated Chimera RNAi ( Cat # H00008934-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB7L1 monoclonal antibody (M03), clone 2B8 (Cat # H00008934-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (48.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RAB7L1.
Immunogen
RAB7L1 (AAH02585, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB7L1 monoclonal antibody (M03), clone 2B8 Western Blot analysis of RAB7L1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB7L1 expression in transfected 293T cell line by RAB7L1 monoclonal antibody (M03), clone 2B8.
Lane 1: RAB7L1 transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB7L1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAB7L1 over-expressed 293 cell line, cotransfected with RAB7L1 Validated Chimera RNAi ( Cat # H00008934-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB7L1 monoclonal antibody (M03), clone 2B8 (Cat # H00008934-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RAB7L1
Entrez GeneID
8934GeneBank Accession#
BC002585Protein Accession#
AAH02585Gene Name
RAB7L1
Gene Alias
DKFZp686P1051, RAB7L
Gene Description
RAB7, member RAS oncogene family-like 1
Omim ID
603949Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000034232|OTTHUMP00000034233|OTTHUMP00000034234
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com