AP1M1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant AP1M1.
Immunogen
AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
Sequence
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.25 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AP1M1 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of AP1M1 expression in U-2 OS ( Cat # L022V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — AP1M1
Entrez GeneID
8907GeneBank Accession#
NM_032493Protein Accession#
NP_115882Gene Name
AP1M1
Gene Alias
AP47, CLAPM2, CLTNM, MU-1A
Gene Description
adaptor-related protein complex 1, mu 1 subunit
Omim ID
603535Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq
Other Designations
HA1 47 kDa subunit|clathrin adaptor protein AP47|clathrin assembly protein complex 1, medium chain|clathrin assembly protein complex AP1, mu subunit|clathrin coat assembly protein AP47|golgi adaptor AP-1 47 kDa protein
-
Interactome
-
Pathway
-
Publication Reference
-
BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice.
Miyamoto Y, Torii T, Tago K, Tanoue A, Takashima S, Yamauchi J.
Science Advances 2018 Apr; 4(4):eaar4471.
Application:WB, Mouse, Sciatic nerves.
-
A novel GTP-binding protein-adaptor protein complex responsible for export of Vangl2 from the trans Golgi network.
Guo Y, Zanetti G, Schekman R.
Elife 2013 Jan; 2:e00160.
Application:WB, Human, Bovine, Human HeLa, Bovine brain.
-
Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 u1A (AP-1 mu1A).
Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Ungsupravate D, Limjindaporn T, Akkarapatumwong V, Noisakran S, Yenchitsomanus PT.
Biochemical and Biophysical Research Communications 2010 Oct; 401(1):85.
Application:IF, Human, HEK 293 cells.
-
BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com