Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1S2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008905-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AP1S2 full-length ORF ( AAH01117, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.01
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008905-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8905
  • Gene Name:
  • AP1S2
  • Gene Alias:
  • DC22,MGC:1902,MRX59,SIGMA1B
  • Gene Description:
  • adaptor-related protein complex 1, sigma 2 subunit
  • Gene Summary:
  • Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022979,adaptor-related protein complex 1 sigma 2 subunit,clathrin adaptor complex AP1 sigma 1B subunit,clathrin assembly protein complex 1 sigma-1B small chain,clathrin-associated/assembly/adaptor protein small 1-like,golgi adaptor HA1/AP1 ada
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook