AP1S2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AP1S2 full-length ORF ( AAH01117, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.01
Interspecies Antigen Sequence
Mouse (98); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AP1S2
Entrez GeneID
8905GeneBank Accession#
BC001117Protein Accession#
AAH01117Gene Name
AP1S2
Gene Alias
DC22, MGC:1902, MRX59, SIGMA1B
Gene Description
adaptor-related protein complex 1, sigma 2 subunit
Gene Ontology
HyperlinkGene Summary
Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022979|adaptor-related protein complex 1 sigma 2 subunit|clathrin adaptor complex AP1 sigma 1B subunit|clathrin assembly protein complex 1 sigma-1B small chain|clathrin-associated/assembly/adaptor protein small 1-like|golgi adaptor HA1/AP1 ada
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com