Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1S2 polyclonal antibody (A01)

  • Catalog # : H00008905-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant AP1S2.
  • Immunogen:
  • AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008905-A01
    Western Blot detection against Immunogen (43.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8905
  • Gene Name:
  • AP1S2
  • Gene Alias:
  • DC22,MGC:1902,MRX59,SIGMA1B
  • Gene Description:
  • adaptor-related protein complex 1, sigma 2 subunit
  • Gene Summary:
  • Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022979,adaptor-related protein complex 1 sigma 2 subunit,clathrin adaptor complex AP1 sigma 1B subunit,clathrin assembly protein complex 1 sigma-1B small chain,clathrin-associated/assembly/adaptor protein small 1-like,golgi adaptor HA1/AP1 ada
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook