CPNE1 monoclonal antibody (M01), clone 8B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CPNE1.
Immunogen
CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CPNE1 monoclonal antibody (M01), clone 8B8 Western Blot analysis of CPNE1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CPNE1 expression in transfected 293T cell line by CPNE1 monoclonal antibody (M01), clone 8B8.
Lane 1: CPNE1 transfected lysate(59.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CPNE1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CPNE1 over-expressed 293 cell line, cotransfected with CPNE1 Validated Chimera RNAi ( Cat # H00008904-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CPNE1 monoclonal antibody (M01), clone 8B8 (Cat # H00008904-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CPNE1
Entrez GeneID
8904GeneBank Accession#
NM_003915Protein Accession#
NP_003906Gene Name
CPNE1
Gene Alias
COPN1, CPN1, MGC1142
Gene Description
copine I
Omim ID
604205Gene Ontology
HyperlinkGene Summary
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq
Other Designations
OTTHUMP00000030775|OTTHUMP00000030776|copine-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com