Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRPF4B (Human) Recombinant Protein (Q02)

  • Catalog # : H00008899-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRPF4B partial ORF ( NP_003904.2, 898 a.a. - 1005 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008899-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8899
  • Gene Name:
  • PRPF4B
  • Gene Alias:
  • KIAA0536,PR4H,PRP4,PRP4H,PRP4K,dJ1013A10.1
  • Gene Description:
  • PRP4 pre-mRNA processing factor 4 homolog B (yeast)
  • Gene Summary:
  • Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000039176,dJ1013A10.1 (PRP4 protein kinase homolog),protein-serine/threonine kinase,serine/threonine-protein kinase PRP4 homolog,serine/threonine-protein kinase PRP4K
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook