CPNE3 monoclonal antibody (M02), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CPNE3 monoclonal antibody (M02), clone 4F4. Western Blot analysis of CPNE3 expression in MCF-7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CPNE3.
Immunogen
CPNE3 (NP_003900.1, 164 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CPNE3 monoclonal antibody (M02), clone 4F4. Western Blot analysis of CPNE3 expression in MCF-7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CPNE3
Entrez GeneID
8895GeneBank Accession#
NM_003909Protein Accession#
NP_003900.1Gene Name
CPNE3
Gene Alias
CPN3, KIAA0636, PRO1071
Gene Description
copine III
Omim ID
604207Gene Ontology
HyperlinkGene Summary
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com