Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF2S2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008894-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF2S2 full-length ORF ( NP_003899.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 64.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008894-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8894
  • Gene Name:
  • EIF2S2
  • Gene Alias:
  • DKFZp686L18198,EIF2,EIF2B,EIF2beta,MGC8508
  • Gene Description:
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • Gene Summary:
  • Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030680,eukaryotic initiation factor 2-beta,eukaryotic translation initiation factor 2 beta,eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • RSS
  • YouTube
  • Linkedin
  • Facebook